(data stored in SCRATCH zone)

EMBL: FM954973.PE205

FM954973.PE205       Location/Qualifiers
FT   CDS             239945..242089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0209"
FT                   /product="putative GGDEF family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25549"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25549.1"
FT                   /translation="MHVKAFAKQISATRDHRLLAESLFDYLIKMLGPQGIGIFSEPIPE
FT                   SDSLPLFSYGELTSLDHYPSTFWPWVSQFDTADGVLPMSLNTCKWEHSKALGGESFIMM
FT                   LDNAPACRTYLIIQNCIAEKVNQTFDQGLDGLQLAAARWQCIRAEKNAAIEIKHRDTRE
FT                   AQYLDEIKLRELFVENMKLVHQVALELSNPESLDALYKASVEAVRDRLGFDRAIFMLLD
FT                   MKKRCFSGTYGTDELGKTNSEHHTQYDLHQLESEYIEALSDNHTNLVVIEHAPLYTEGK
FT                   VVGQGWNGMLILREGDKPVGWIAMDNYIHRSPITNYQKQMLESFGSLLSQIYIRKRQEL
FT                   NIRMLHSSMVELSRCDSVSAVCKSAVSFAIQHLGIDRLAVFLTDKNCSYMQGTWGTDIK
FT                   GDIVDESYYRSELVERDIVSAARTYPNQVAFEESVPIYHDYNIVGVGWTAMTMLTTNTG
FT                   VPIAFIAADNLLTRSPLTSQLREVIRIFASSLAEVLQRTMAQEEIKKLNETLEQEVSKR
FT                   TQELENANEQLDVISKLDPLTRLGNRRMLSQVLDDLNCEEHGAFATQNEVTFGLILVDL
FT                   DHFGLYNSVYGHTEGDVALRAIGKILSTHVYGDQETFCRIGGEEFMLLMIGTNHTTTKQ
FT                   RAESIRQSIEDAKIFHCKSSTSQYLTASVGYASITSDQRQFDFDLLYGKADKALYKAKD
FT                   SGRNRVVSAMKRRKVAATLT"
     MHVKAFAKQI SATRDHRLLA ESLFDYLIKM LGPQGIGIFS EPIPESDSLP LFSYGELTSL        60
     DHYPSTFWPW VSQFDTADGV LPMSLNTCKW EHSKALGGES FIMMLDNAPA CRTYLIIQNC       120
     IAEKVNQTFD QGLDGLQLAA ARWQCIRAEK NAAIEIKHRD TREAQYLDEI KLRELFVENM       180
     KLVHQVALEL SNPESLDALY KASVEAVRDR LGFDRAIFML LDMKKRCFSG TYGTDELGKT       240
     NSEHHTQYDL HQLESEYIEA LSDNHTNLVV IEHAPLYTEG KVVGQGWNGM LILREGDKPV       300
     GWIAMDNYIH RSPITNYQKQ MLESFGSLLS QIYIRKRQEL NIRMLHSSMV ELSRCDSVSA       360
     VCKSAVSFAI QHLGIDRLAV FLTDKNCSYM QGTWGTDIKG DIVDESYYRS ELVERDIVSA       420
     ARTYPNQVAF EESVPIYHDY NIVGVGWTAM TMLTTNTGVP IAFIAADNLL TRSPLTSQLR       480
     EVIRIFASSL AEVLQRTMAQ EEIKKLNETL EQEVSKRTQE LENANEQLDV ISKLDPLTRL       540
     GNRRMLSQVL DDLNCEEHGA FATQNEVTFG LILVDLDHFG LYNSVYGHTE GDVALRAIGK       600
     ILSTHVYGDQ ETFCRIGGEE FMLLMIGTNH TTTKQRAESI RQSIEDAKIF HCKSSTSQYL       660
     TASVGYASIT SDQRQFDFDL LYGKADKALY KAKDSGRNRV VSAMKRRKVA ATLT             714
//

If you have problems or comments...

PBIL Back to PBIL home page