(data stored in SCRATCH zone)

EMBL: FM954973.PE206

FM954973.PE206       Location/Qualifiers
FT   CDS             complement(242225..243916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0210"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25551"
FT                   /db_xref="GOA:B7VQH9"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25551.1"
FT                   /translation="MVTMRSLNKPFFSILLTLLLGAFSSFSALAATAVASVSQNSVTKD
FT                   EVFLLRVATDEKVSSGALDLTSLQKNFYVGTPSFGSSMRIVNGSRTVSSEWNITLAPLR
FT                   LGRLDIPSFDIEGTKTQPITINVSINKAAPKQSDMAEFQLNLSKDSLYPQEVAELDVKL
FT                   IIKADPRRLQDPQISLPNSSNLDVEPIGESKQFQDVINGQEVTVVQQSFHISSQQAGQF
FT                   QLQGPKLTGAVVYSTNNSSKTRLFQLDTPVESLNVTVKPVPKGYQGEWLPTSDFKLLQK
FT                   WSDSQGNELTDSNGFDSNKQGFELEAGDSLTRTITMTASNLTQHQLPKLNITYPKSIRV
FT                   YEEKPQFGTTQPGDAVVVYKQILIPKEAGNISLPDVSQAWFNTDTQSEQTTKALGLELS
FT                   VQASERASSSSPAPAMETPTQQASPTIVTVENPGMWPYLTALFAALWIISSAVAFYFWS
FT                   RRGTAVKQKQKDECQSDTAEALIAALKMKDGVKTRTLFEQWKTENPDLSDETLETIEAE
FT                   LTKLNQSLYAEACSPSQSWDPSEAIKAVKKPKRISNKAHKSTLERL"
     MVTMRSLNKP FFSILLTLLL GAFSSFSALA ATAVASVSQN SVTKDEVFLL RVATDEKVSS        60
     GALDLTSLQK NFYVGTPSFG SSMRIVNGSR TVSSEWNITL APLRLGRLDI PSFDIEGTKT       120
     QPITINVSIN KAAPKQSDMA EFQLNLSKDS LYPQEVAELD VKLIIKADPR RLQDPQISLP       180
     NSSNLDVEPI GESKQFQDVI NGQEVTVVQQ SFHISSQQAG QFQLQGPKLT GAVVYSTNNS       240
     SKTRLFQLDT PVESLNVTVK PVPKGYQGEW LPTSDFKLLQ KWSDSQGNEL TDSNGFDSNK       300
     QGFELEAGDS LTRTITMTAS NLTQHQLPKL NITYPKSIRV YEEKPQFGTT QPGDAVVVYK       360
     QILIPKEAGN ISLPDVSQAW FNTDTQSEQT TKALGLELSV QASERASSSS PAPAMETPTQ       420
     QASPTIVTVE NPGMWPYLTA LFAALWIISS AVAFYFWSRR GTAVKQKQKD ECQSDTAEAL       480
     IAALKMKDGV KTRTLFEQWK TENPDLSDET LETIEAELTK LNQSLYAEAC SPSQSWDPSE       540
     AIKAVKKPKR ISNKAHKSTL ERL                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page