(data stored in SCRATCH zone)

EMBL: FM954973.PE209

FM954973.PE209       Location/Qualifiers
FT   CDS             complement(246717..247250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0213"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25556"
FT                   /db_xref="GOA:B7VQI2"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25556.1"
FT                   /translation="MCAIVNEPSIRSSVMNQPLDLSPIITPSAPSWWPLAWGWWLIIIT
FT                   AIVLIALVFFIIKRRQKNQYAKNEALACFRNSLPSNTLSPSAAQDIVRQAALSYFPREK
FT                   VAGLSGDDWLAFLDAQLAKPLFAAKQSQWQWQQALYQDTTLMSDEQTKAQQQLVNDCEI
FT                   WLRKALPPKRGRYE"
     MCAIVNEPSI RSSVMNQPLD LSPIITPSAP SWWPLAWGWW LIIITAIVLI ALVFFIIKRR        60
     QKNQYAKNEA LACFRNSLPS NTLSPSAAQD IVRQAALSYF PREKVAGLSG DDWLAFLDAQ       120
     LAKPLFAAKQ SQWQWQQALY QDTTLMSDEQ TKAQQQLVND CEIWLRKALP PKRGRYE          177
//

If you have problems or comments...

PBIL Back to PBIL home page