(data stored in SCRATCH zone)

EMBL: FM954973.PE219

FM954973.PE219       Location/Qualifiers
FT   CDS             complement(258382..258654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0223"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25573"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25573.1"
FT                   /translation="MYLNFLEPLLSTTFPTLCESTLTNLKAVEYQWVRSLYVEGYDTNE
FT                   INHYIQACFGGDQTFADLFRRVALYQDSIYVLLQHLGCAPSSKEF"
     MYLNFLEPLL STTFPTLCES TLTNLKAVEY QWVRSLYVEG YDTNEINHYI QACFGGDQTF        60
     ADLFRRVALY QDSIYVLLQH LGCAPSSKEF                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page