(data stored in SCRATCH zone)

EMBL: FM954973.PE251

FM954973.PE251       Location/Qualifiers
FT   CDS             complement(293136..294467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0256"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25630"
FT                   /db_xref="GOA:B7VQM4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25630.1"
FT                   /translation="MTLKEILNIPNVRYFLMFRSSYFARFYYPIFTLLYLDYGLTLSQF
FT                   AMLNVVWAATIVLAEVPSGAFADTLGRKKLVVLSSIVMFVEIAMIALVPTGNPDLVFIV
FT                   FLINRILSGLAMALASGADEALAYDTLKEQGNEELWPRVLQIQLRVASTVGIFVTLIGA
FT                   AMYDVNFMANIFHFLGLSEPESTKDLMRIPVFATLFVAMIAIYAAINMREEKKVMPSDQ
FT                   TKLATTIASLKLTADTGKWVLATPYVLFMLLYYSLFEHTSRMFLTMNSQYYLAIDIPII
FT                   YFGFIGAGISLLKIILAGQSRRLAESMEPKTFIVVMGLASMATYYWISLGWTIYGVIPA
FT                   LVLIFIIMTMNIFISYHLNKKTESHNRATVLSFKGLMFNLGYGLIGILYAYYYKLVSQG
FT                   YTEQEIEQNLAFLASLSSFFYYFTLLFVLISALFYFKNKKQPIF"
     MTLKEILNIP NVRYFLMFRS SYFARFYYPI FTLLYLDYGL TLSQFAMLNV VWAATIVLAE        60
     VPSGAFADTL GRKKLVVLSS IVMFVEIAMI ALVPTGNPDL VFIVFLINRI LSGLAMALAS       120
     GADEALAYDT LKEQGNEELW PRVLQIQLRV ASTVGIFVTL IGAAMYDVNF MANIFHFLGL       180
     SEPESTKDLM RIPVFATLFV AMIAIYAAIN MREEKKVMPS DQTKLATTIA SLKLTADTGK       240
     WVLATPYVLF MLLYYSLFEH TSRMFLTMNS QYYLAIDIPI IYFGFIGAGI SLLKIILAGQ       300
     SRRLAESMEP KTFIVVMGLA SMATYYWISL GWTIYGVIPA LVLIFIIMTM NIFISYHLNK       360
     KTESHNRATV LSFKGLMFNL GYGLIGILYA YYYKLVSQGY TEQEIEQNLA FLASLSSFFY       420
     YFTLLFVLIS ALFYFKNKKQ PIF                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page