(data stored in SCRATCH zone)

EMBL: FM954973.PE271

FM954973.PE271       Location/Qualifiers
FT   CDS             320854..321375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25664"
FT                   /db_xref="GOA:B7VQP4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25664.1"
FT                   /translation="MEKIAIFGSAFNPPSLGHKSVIDSLAHFDKILLVPSIAHAWGKEM
FT                   LDFDTRCQLVNAFISDLSLEQVELSLVEKSLFTPGESVTTYTVLSALQKLHRDAELTFV
FT                   IGPDNFFKFSSFYKSDEITEQWSVMACPEKVKIRSTDIRNALISGSDVAKLSTKSVTKI
FT                   LQDSGLYTIM"
     MEKIAIFGSA FNPPSLGHKS VIDSLAHFDK ILLVPSIAHA WGKEMLDFDT RCQLVNAFIS        60
     DLSLEQVELS LVEKSLFTPG ESVTTYTVLS ALQKLHRDAE LTFVIGPDNF FKFSSFYKSD       120
     EITEQWSVMA CPEKVKIRST DIRNALISGS DVAKLSTKSV TKILQDSGLY TIM              173
//

If you have problems or comments...

PBIL Back to PBIL home page