(data stored in SCRATCH zone)

EMBL: FM954973.PE272

FM954973.PE272       Location/Qualifiers
FT   CDS             321404..321889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25666"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25666.1"
FT                   /translation="MLKRAIPATMIIAACSLPAYAECDFFSLDSVMLTSDDENSCLDFS
FT                   TSLEAFGQSMLELSGLSEPEPQTKPDYWSDWVIQSKDAPLLTQSLESNYVGLGMWFPEE
FT                   LEDEQYNMSTEEWLMNHGLQLSIGFGDKVEGQPRMRFDYRWHDSSDADLMMQVELPF"
     MLKRAIPATM IIAACSLPAY AECDFFSLDS VMLTSDDENS CLDFSTSLEA FGQSMLELSG        60
     LSEPEPQTKP DYWSDWVIQS KDAPLLTQSL ESNYVGLGMW FPEELEDEQY NMSTEEWLMN       120
     HGLQLSIGFG DKVEGQPRMR FDYRWHDSSD ADLMMQVELP F                           161
//

If you have problems or comments...

PBIL Back to PBIL home page