(data stored in SCRATCH zone)

EMBL: FM954973.PE281

FM954973.PE281       Location/Qualifiers
FT   CDS             complement(328699..329589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0286"
FT                   /product="hemin ABC transporter, periplasmic hemin-binding
FT                   protein HutB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25681"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25681.1"
FT                   /translation="MKDLKVLNKLKNNKHLLAIAAMGLVLAAPIANADDAKQPRIISAG
FT                   SAVTELVLALGAEEQLIAIDVTSHLPQSKTLPKIGYHRNLSAEGLIALSPTTLIGSDEM
FT                   GPDNAISQLKSVGIDVEIVNTEANVEGLLKRIDQIAKITHTEAHSQQVKAEVNQKIAAL
FT                   KANQVPNNEAKKVLFLLLHEGRPANVAGGETSPNAIIELAGGVNPAAKSLTSYKPLSME
FT                   SLVEMQPDVILVSGRSYQKIGGADAILKSLPMLAATPAGMNKQIITVKGSALVGGLGLE
FT                   SLSEAKRINALIYPL"
     MKDLKVLNKL KNNKHLLAIA AMGLVLAAPI ANADDAKQPR IISAGSAVTE LVLALGAEEQ        60
     LIAIDVTSHL PQSKTLPKIG YHRNLSAEGL IALSPTTLIG SDEMGPDNAI SQLKSVGIDV       120
     EIVNTEANVE GLLKRIDQIA KITHTEAHSQ QVKAEVNQKI AALKANQVPN NEAKKVLFLL       180
     LHEGRPANVA GGETSPNAII ELAGGVNPAA KSLTSYKPLS MESLVEMQPD VILVSGRSYQ       240
     KIGGADAILK SLPMLAATPA GMNKQIITVK GSALVGGLGL ESLSEAKRIN ALIYPL           296
//

If you have problems or comments...

PBIL Back to PBIL home page