(data stored in SCRATCH zone)

EMBL: FM954973.PE300

FM954973.PE300       Location/Qualifiers
FT   CDS             348902..350107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0305"
FT                   /product="Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25713"
FT                   /db_xref="GOA:B7VQS3"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25713.1"
FT                   /translation="MSQSTFKKTPLLLAMMIIATGQVGVSIYLPSLPLIASDLSVTQVD
FT                   VQLLVTLFLVGFGLSQLFYGPMSDAVGRRPIFLLGQGVYLIGTVVCVVFSDNMTALEVG
FT                   RLLQGLGAGSASVLGRSVLRDSYDGLQLTKALSYISVTASIMPIIAPVFGGWISFHLGW
FT                   QAVFLFVLVYLLAIFTLGYFVLHETLPYGKSRFEVSQVVKNYGRLLTNRQVLTSASYNW
FT                   MSYMASLVSLSLFPFLMQEQLGLTAAEYGSLMIVPSAGLLIGSVALNLLNRRFSTPQLM
FT                   SLAILIILASGTWLLTHELSIFNLVWAFTWLAIAQGISFPLSISMLLEPHKKKAGAVSA
FT                   LSGSIQMCLAGLLGGYLVESWVTTHLQLGVFYLIIGACMATVLWSSTRMNKKATATEVE
FT                   YS"
     MSQSTFKKTP LLLAMMIIAT GQVGVSIYLP SLPLIASDLS VTQVDVQLLV TLFLVGFGLS        60
     QLFYGPMSDA VGRRPIFLLG QGVYLIGTVV CVVFSDNMTA LEVGRLLQGL GAGSASVLGR       120
     SVLRDSYDGL QLTKALSYIS VTASIMPIIA PVFGGWISFH LGWQAVFLFV LVYLLAIFTL       180
     GYFVLHETLP YGKSRFEVSQ VVKNYGRLLT NRQVLTSASY NWMSYMASLV SLSLFPFLMQ       240
     EQLGLTAAEY GSLMIVPSAG LLIGSVALNL LNRRFSTPQL MSLAILIILA SGTWLLTHEL       300
     SIFNLVWAFT WLAIAQGISF PLSISMLLEP HKKKAGAVSA LSGSIQMCLA GLLGGYLVES       360
     WVTTHLQLGV FYLIIGACMA TVLWSSTRMN KKATATEVEY S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page