(data stored in SCRATCH zone)

EMBL: FM954973.PE310

FM954973.PE310       Location/Qualifiers
FT   CDS             complement(357665..358150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25731"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25731.1"
FT                   /translation="MKKMEAPHDMNNGARFKTNRHGYVTVVEYYNTYTVIVAFENTGNI
FT                   RAISATKLRTGQLTDRSVAPESIMIGEKVESVKHGILTITQVESENIVVLTNINNEEIR
FT                   MLLPAVQKMKDKTEEIDGENVTSPKPTSLSQLTKRNKKTKDVNSMLKKMLTDYGRYD"
     MKKMEAPHDM NNGARFKTNR HGYVTVVEYY NTYTVIVAFE NTGNIRAISA TKLRTGQLTD        60
     RSVAPESIMI GEKVESVKHG ILTITQVESE NIVVLTNINN EEIRMLLPAV QKMKDKTEEI       120
     DGENVTSPKP TSLSQLTKRN KKTKDVNSML KKMLTDYGRY D                           161
//

If you have problems or comments...

PBIL Back to PBIL home page