(data stored in SCRATCH zone)

EMBL: FM954973.PE320

FM954973.PE320       Location/Qualifiers
FT   CDS             complement(370524..370754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0326"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25748"
FT                   /db_xref="GOA:B7VQU3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25748.1"
FT                   /translation="MNKGQIMSNTNTGTVKWFNEEKGFGFISQDNGGADVFVHFRAIAS
FT                   EGFKTLKEGQKVSFEVENGQKGLQAANVVAQ"
     MNKGQIMSNT NTGTVKWFNE EKGFGFISQD NGGADVFVHF RAIASEGFKT LKEGQKVSFE        60
     VENGQKGLQA ANVVAQ                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page