(data stored in SCRATCH zone)

EMBL: FM954973.PE342

FM954973.PE342       Location/Qualifiers
FT   CDS             complement(393850..394086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0349"
FT                   /product="putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25785"
FT                   /db_xref="GOA:B7VQW5"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25785.1"
FT                   /translation="MKTMTQRFQTLLSVSNFSLAITALLMLLSIIVAYPMADYFSLPIQ
FT                   IFAHISTILVAGLLKISYVGRCVAQYSLGQEVR"
     MKTMTQRFQT LLSVSNFSLA ITALLMLLSI IVAYPMADYF SLPIQIFAHI STILVAGLLK        60
     ISYVGRCVAQ YSLGQEVR                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page