(data stored in SCRATCH zone)

EMBL: FM954973.PE354

FM954973.PE354       Location/Qualifiers
FT   CDS             403968..405026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0361"
FT                   /product="outer membrane protein N"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25806"
FT                   /db_xref="GOA:B7VQX7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25806.1"
FT                   /translation="MNKKLLALAISGAVFGTQAVAVELYNEDGTAFSVGGHVSVNLNGS
FT                   EKGDTDVGTNSPRINFNATQELGNGFTADAKGEWALNYLNGGDESFTTRLGYVGLTHDE
FT                   LGRAVAGTQWAPYYDVASATDMPIAFANDFLYDNHGALGTGRADKMASYRNGFDFGEAG
FT                   ELSFGLGWQGSNTVTTDVYDDTDINDIIHSRTTVAYDDRIQATLGYSIAGVKLGYAFNT
FT                   GDFKEGGVSKTAESHLVSAAYGSYGSGLYLAGIYASNENMNAGLEESDAYELLAAYALA
FT                   NSLNLSVNYEVVEGEATKGAATQTDREELALQAEYNFTSNVVGYTGYQFDLNDADNRKT
FT                   DDKWTIGARFYL"
     MNKKLLALAI SGAVFGTQAV AVELYNEDGT AFSVGGHVSV NLNGSEKGDT DVGTNSPRIN        60
     FNATQELGNG FTADAKGEWA LNYLNGGDES FTTRLGYVGL THDELGRAVA GTQWAPYYDV       120
     ASATDMPIAF ANDFLYDNHG ALGTGRADKM ASYRNGFDFG EAGELSFGLG WQGSNTVTTD       180
     VYDDTDINDI IHSRTTVAYD DRIQATLGYS IAGVKLGYAF NTGDFKEGGV SKTAESHLVS       240
     AAYGSYGSGL YLAGIYASNE NMNAGLEESD AYELLAAYAL ANSLNLSVNY EVVEGEATKG       300
     AATQTDREEL ALQAEYNFTS NVVGYTGYQF DLNDADNRKT DDKWTIGARF YL               352
//

If you have problems or comments...

PBIL Back to PBIL home page