(data stored in SCRATCH zone)

EMBL: FM954973.PE358

FM954973.PE358       Location/Qualifiers
FT   CDS             409209..410468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0365"
FT                   /product="Cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25813"
FT                   /db_xref="GOA:B7VQY1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25813.1"
FT                   /translation="MKRLLVRLAWLLKSFVVVLVSPLVHASSEYNMTQGVTEISGKVYE
FT                   LHMLIFYICCAIAFVVFGVMFYSILRHRKSKGAVAAHFHESTKVEILWTIIPIIILIAM
FT                   AIPATKTLIAMEDTSQSDLTVKITGSQWKWHYSYFGEDVEFFSLLATSDKEIEGIEVKG
FT                   AHYLLEVDKPLVLPINRKVRFLMTSDDVIHSWWVPAFAVKKDTIPGFINEAWTKIDEPG
FT                   VYRGQCAELCGRAHGFMPIVVHAMEEAEYDAWLAEQKELAVAAQQAAQDALDASLSLEE
FT                   LNTIGEEVYKTRCAVCHQVNGEGIPGAFPAIKGSPIALGDVDVHIDTIVYGRGGTAMQA
FT                   FDNQLTEKEIAAVVTYQRNAWGNDTGDIVQASDVNAYKAKQEGGEQASDEQGSTDETQG
FT                   STDETQGLMDEAQNDAKEQL"
     MKRLLVRLAW LLKSFVVVLV SPLVHASSEY NMTQGVTEIS GKVYELHMLI FYICCAIAFV        60
     VFGVMFYSIL RHRKSKGAVA AHFHESTKVE ILWTIIPIII LIAMAIPATK TLIAMEDTSQ       120
     SDLTVKITGS QWKWHYSYFG EDVEFFSLLA TSDKEIEGIE VKGAHYLLEV DKPLVLPINR       180
     KVRFLMTSDD VIHSWWVPAF AVKKDTIPGF INEAWTKIDE PGVYRGQCAE LCGRAHGFMP       240
     IVVHAMEEAE YDAWLAEQKE LAVAAQQAAQ DALDASLSLE ELNTIGEEVY KTRCAVCHQV       300
     NGEGIPGAFP AIKGSPIALG DVDVHIDTIV YGRGGTAMQA FDNQLTEKEI AAVVTYQRNA       360
     WGNDTGDIVQ ASDVNAYKAK QEGGEQASDE QGSTDETQGS TDETQGLMDE AQNDAKEQL        419
//

If you have problems or comments...

PBIL Back to PBIL home page