(data stored in SCRATCH zone)

EMBL: FM954973.PE366

FM954973.PE366       Location/Qualifiers
FT   CDS             417691..418044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25828"
FT                   /db_xref="GOA:B7VQY9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25828.1"
FT                   /translation="MEFTEQDRDALYQTWMSQKSRMRITQMEFSKKLGMNQLDFSRVLR
FT                   GEKALTMSFVSHFCRLLHLEPRNVLPSLKEDNESGPKVVYLKSRMSVDGEIQNAYIEGN
FT                   QVIVEYAHTVQNH"
     MEFTEQDRDA LYQTWMSQKS RMRITQMEFS KKLGMNQLDF SRVLRGEKAL TMSFVSHFCR        60
     LLHLEPRNVL PSLKEDNESG PKVVYLKSRM SVDGEIQNAY IEGNQVIVEY AHTVQNH          117
//

If you have problems or comments...

PBIL Back to PBIL home page