(data stored in SCRATCH zone)

EMBL: FM954973.PE375

FM954973.PE375       Location/Qualifiers
FT   CDS             423194..423523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25843"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25843.1"
FT                   /translation="MTYCKINEMKVSPTMAGYLREIESKVELGNLLAISVSSIPLLELF
FT                   TTRVAPHTRIKEIGEYDWEQFGSAMLSIYPTTRRLVNVIADEARLYSKNRQEVQFWSCV
FT                   YDATR"
     MTYCKINEMK VSPTMAGYLR EIESKVELGN LLAISVSSIP LLELFTTRVA PHTRIKEIGE        60
     YDWEQFGSAM LSIYPTTRRL VNVIADEARL YSKNRQEVQF WSCVYDATR                   109
//

If you have problems or comments...

PBIL Back to PBIL home page