(data stored in SCRATCH zone)

EMBL: FM954973.PE393

FM954973.PE393       Location/Qualifiers
FT   CDS             443500..444609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0401"
FT                   /product="ABC transporter: ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25874"
FT                   /db_xref="GOA:B7VR16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25874.1"
FT                   /translation="MSNQTYLNIENVVKQFGQFTALKDISLSIDKGEFVCFLGPSGCGK
FT                   TTLLRAIAGLDLPTSGSIEQNGNDTTFLPPEKRDFGIVFQSYALFPNLTVEENIAIGLK
FT                   NQGMSTKEALETVESWLETIGLPTSGQKFPNQLSGGQQQRVALARALALSPGLLLLDEP
FT                   LSALDAKVRTHLRDEICQLQRKLGITTIMVTHDQDEALTMADRIVVMNHGVIEQVGAPQ
FT                   EIYQKPVSRFVAEFVGSMNFIQASVAAQGKMRIAESMLPLPGLDNLTPKLGDVFDIAVR
FT                   PEQIQFVDRFSESFPVRIVSSEFLGAFYRVECQLQHDSTAKEIIVDVSVKEFNQLKLRR
FT                   SDIRYVAFDQEGLRAYPSKSLQVMKDEAA"
     MSNQTYLNIE NVVKQFGQFT ALKDISLSID KGEFVCFLGP SGCGKTTLLR AIAGLDLPTS        60
     GSIEQNGNDT TFLPPEKRDF GIVFQSYALF PNLTVEENIA IGLKNQGMST KEALETVESW       120
     LETIGLPTSG QKFPNQLSGG QQQRVALARA LALSPGLLLL DEPLSALDAK VRTHLRDEIC       180
     QLQRKLGITT IMVTHDQDEA LTMADRIVVM NHGVIEQVGA PQEIYQKPVS RFVAEFVGSM       240
     NFIQASVAAQ GKMRIAESML PLPGLDNLTP KLGDVFDIAV RPEQIQFVDR FSESFPVRIV       300
     SSEFLGAFYR VECQLQHDST AKEIIVDVSV KEFNQLKLRR SDIRYVAFDQ EGLRAYPSKS       360
     LQVMKDEAA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page