(data stored in SCRATCH zone)

EMBL: FM954973.PE399

FM954973.PE399       Location/Qualifiers
FT   CDS             449986..451308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0407"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25885"
FT                   /db_xref="GOA:B7VR22"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25885.1"
FT                   /translation="MFDLSSIGIAWGSLLMLVMMIGLLLTGMQLAFVTGFVAIFFTLCW
FT                   FGPDALPLIASRTYSFASGYVFLAVPMFVLMAALLDRSGIARDLFDAMKSVGRKVRGGV
FT                   AVQTLLVAVLLASMSGVIGGETVLLGILALPQMLRLGYDRKLAIGTTCAGGALGTMLPP
FT                   SIVLIIYGMTASVSIGDLFKASFLPAFILAGCYIGYVLIRCKLNPSLAPIPSDDETEED
FT                   IANQPSYFKALFFPLLSVATVLGSIYTGIASVTEASALGVVGIMISALIRGELNYNMLK
FT                   ESAIATMRTCGMIMWIGIGASALVGIYNLMGGIDFVEETILALSGGNATVTLLIMMAIL
FT                   LVLGMFLDWVGVALLTMPIFVPIITGLGFDPVWFGVVFCLNMQVSFLSPPFGPAAFYLK
FT                   SVAPKDISLGEIFSSLLPFIALQVLVLALVIIFPQLALWWQ"
     MFDLSSIGIA WGSLLMLVMM IGLLLTGMQL AFVTGFVAIF FTLCWFGPDA LPLIASRTYS        60
     FASGYVFLAV PMFVLMAALL DRSGIARDLF DAMKSVGRKV RGGVAVQTLL VAVLLASMSG       120
     VIGGETVLLG ILALPQMLRL GYDRKLAIGT TCAGGALGTM LPPSIVLIIY GMTASVSIGD       180
     LFKASFLPAF ILAGCYIGYV LIRCKLNPSL APIPSDDETE EDIANQPSYF KALFFPLLSV       240
     ATVLGSIYTG IASVTEASAL GVVGIMISAL IRGELNYNML KESAIATMRT CGMIMWIGIG       300
     ASALVGIYNL MGGIDFVEET ILALSGGNAT VTLLIMMAIL LVLGMFLDWV GVALLTMPIF       360
     VPIITGLGFD PVWFGVVFCL NMQVSFLSPP FGPAAFYLKS VAPKDISLGE IFSSLLPFIA       420
     LQVLVLALVI IFPQLALWWQ                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page