(data stored in SCRATCH zone)

EMBL: FM954973.PE410

FM954973.PE410       Location/Qualifiers
FT   CDS             463412..465523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0418"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25903"
FT                   /db_xref="InterPro:IPR031025"
FT                   /db_xref="InterPro:IPR032295"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25903.1"
FT                   /translation="MKYKQVIYLMTAVASAPVYATTVDLDFSNHVEATNGSSSWAGPTY
FT                   DGSSMHFLNVGTHDGKTIDAKVSSSVFGDATFLFHAPNYKVGATQPSGDIGFLYQTNSA
FT                   GSAGLTYTFEFYDGTDGLSGTFSVPYTLPEFDMIGYDIDGEPVQSEQVRVFKSEGFYSY
FT                   QLGSASASLMAEESADGTSVLFTGPGTNYSETDTSGAVKFTYKNTSIVTLQFETVTSSS
FT                   SSFPNPIFSAFDGNWDLSGFTTPIESSDESDFGDAPDSYGTLQASNGAEHAISSTLYLG
FT                   ASVDADTDGQPGASSNGDDLDVGGNDDDGIALLTNLEVGLDSLINVNVVGSGYLQAWAD
FT                   WDMNGSFEDDEQILKNHSVVDGSQVVPIRVGDDAVVGSVQTRFRLASSPNIPSDGYVGD
FT                   GEVEDYVFNVTDPGTTVQHSNYYTAAFEDNWPEVGDFDLNDVVVYYRTTILSKEDAVLR
FT                   MDITGTIMAYGASYGNGLGWKLSGFDESDVDLQTARVQKNGATRVNISPFTGEDKSVAS
FT                   PGGDLVVVASLNLKNDLPINGECMFHRTNPSCSPTLEADQMTFSISLPFASGSEPTASS
FT                   LMPLSGFDPFIFGAGAGYYHGDSFSTSPGKDLEIHTADFPPTSRGTLVSDFYGIAQDDS
FT                   DPSSDKYYRTTQNMPWGILISSSWNHPSEYIDVSEVYPEFAEWATSGGASKPTWYQNPN
FT                   ANKTWSTED"
     MKYKQVIYLM TAVASAPVYA TTVDLDFSNH VEATNGSSSW AGPTYDGSSM HFLNVGTHDG        60
     KTIDAKVSSS VFGDATFLFH APNYKVGATQ PSGDIGFLYQ TNSAGSAGLT YTFEFYDGTD       120
     GLSGTFSVPY TLPEFDMIGY DIDGEPVQSE QVRVFKSEGF YSYQLGSASA SLMAEESADG       180
     TSVLFTGPGT NYSETDTSGA VKFTYKNTSI VTLQFETVTS SSSSFPNPIF SAFDGNWDLS       240
     GFTTPIESSD ESDFGDAPDS YGTLQASNGA EHAISSTLYL GASVDADTDG QPGASSNGDD       300
     LDVGGNDDDG IALLTNLEVG LDSLINVNVV GSGYLQAWAD WDMNGSFEDD EQILKNHSVV       360
     DGSQVVPIRV GDDAVVGSVQ TRFRLASSPN IPSDGYVGDG EVEDYVFNVT DPGTTVQHSN       420
     YYTAAFEDNW PEVGDFDLND VVVYYRTTIL SKEDAVLRMD ITGTIMAYGA SYGNGLGWKL       480
     SGFDESDVDL QTARVQKNGA TRVNISPFTG EDKSVASPGG DLVVVASLNL KNDLPINGEC       540
     MFHRTNPSCS PTLEADQMTF SISLPFASGS EPTASSLMPL SGFDPFIFGA GAGYYHGDSF       600
     STSPGKDLEI HTADFPPTSR GTLVSDFYGI AQDDSDPSSD KYYRTTQNMP WGILISSSWN       660
     HPSEYIDVSE VYPEFAEWAT SGGASKPTWY QNPNANKTWS TED                         703
//

If you have problems or comments...

PBIL Back to PBIL home page