(data stored in SCRATCH zone)

EMBL: FM954973.PE432

FM954973.PE432       Location/Qualifiers
FT   CDS             complement(489208..491133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0440"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   protein kefC (K(+)/H(+)antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25939"
FT                   /db_xref="GOA:B7VR55"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25939.1"
FT                   /translation="MTGYFLQAFIYLLAAVIAVPIAKRLGLGSVLGYLIAGVVIGPIIG
FT                   LVGEETTTIQHFAEFGVVMMLFLVGLELEPKMLWAMRNRLMGLGGLQVGGTTAIVMGIA
FT                   LFFGQPWTIALTIGLIFALSSTAIVLQTFNEKGLSKTEGGKNAFSVLLFQDIAVIPMLA
FT                   FIPLLALPELIEAAQSAVASASDHHEELSLVAGLPGWAYGLVITASIAIVVVGGHFLSR
FT                   PLFRFVASSGLREIFTATALMLVIGIAALMSLVGLSPALGTFLAGVVLANSEFRHELES
FT                   NIDPFKGLLLGLFFITVGAGINFDVLFNDFGLIIGLTLGVMLLKALVLFTLALIFKIRN
FT                   SDRWLFTLSLAQAGEFGFVLLSFSAQNHVLPADIVQTLSLVVALSMFLTPGLFILFDKV
FT                   ILPRYEQKSNDREADTIEEKGTVIIAGIGRFGQIVNRLLVSNDVNTVVLDHQANQVDLL
FT                   RSINIKSYFGDATRHDLLHTAGIEEAAMFVVAIDNQDSSVELVKYVKHTYPNVKILARA
FT                   FDRGHSYRLREAGADSVVSETYHSALEMGAEALRSLGHHPFFVEQQKSTYQRVESRKSE
FT                   KLYQAWSEAEENPRYDNNYRQIFIHLEEAMKEDMKKDRSDKHSRSERGWTPPPKGYADG
FT                   FEEEQT"
     MTGYFLQAFI YLLAAVIAVP IAKRLGLGSV LGYLIAGVVI GPIIGLVGEE TTTIQHFAEF        60
     GVVMMLFLVG LELEPKMLWA MRNRLMGLGG LQVGGTTAIV MGIALFFGQP WTIALTIGLI       120
     FALSSTAIVL QTFNEKGLSK TEGGKNAFSV LLFQDIAVIP MLAFIPLLAL PELIEAAQSA       180
     VASASDHHEE LSLVAGLPGW AYGLVITASI AIVVVGGHFL SRPLFRFVAS SGLREIFTAT       240
     ALMLVIGIAA LMSLVGLSPA LGTFLAGVVL ANSEFRHELE SNIDPFKGLL LGLFFITVGA       300
     GINFDVLFND FGLIIGLTLG VMLLKALVLF TLALIFKIRN SDRWLFTLSL AQAGEFGFVL       360
     LSFSAQNHVL PADIVQTLSL VVALSMFLTP GLFILFDKVI LPRYEQKSND READTIEEKG       420
     TVIIAGIGRF GQIVNRLLVS NDVNTVVLDH QANQVDLLRS INIKSYFGDA TRHDLLHTAG       480
     IEEAAMFVVA IDNQDSSVEL VKYVKHTYPN VKILARAFDR GHSYRLREAG ADSVVSETYH       540
     SALEMGAEAL RSLGHHPFFV EQQKSTYQRV ESRKSEKLYQ AWSEAEENPR YDNNYRQIFI       600
     HLEEAMKEDM KKDRSDKHSR SERGWTPPPK GYADGFEEEQ T                           641
//

If you have problems or comments...

PBIL Back to PBIL home page