(data stored in SCRATCH zone)

EMBL: FM954973.PE438

FM954973.PE438       Location/Qualifiers
FT   CDS             complement(496712..496897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0446"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25949"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25949.1"
FT                   /translation="MKHFLPSSVMLTPFLVKYYDEQPEDTSDALDTDESQQPQIEANDD
FT                   SRKPSTQTELEPTLSE"
     MKHFLPSSVM LTPFLVKYYD EQPEDTSDAL DTDESQQPQI EANDDSRKPS TQTELEPTLS        60
     E                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page