(data stored in SCRATCH zone)

EMBL: FM954973.PE447

FM954973.PE447       Location/Qualifiers
FT   CDS             506514..507401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0455"
FT                   /product="Pyruvate formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25965"
FT                   /db_xref="GOA:B7VR70"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25965.1"
FT                   /translation="MARVKNNKTEKQAKVSRVLTFSCVDGPGNRLVLFLQGCNFDCITC
FT                   HNPHTINHCNHCGDCVSGCPSSALSLIEGKVKWDPLACTNCDQCVDICDHKSSPKITTM
FT                   TVSDVLELVRHNQFFLSGITVSGGEATMQLPFIVELFQAIKSDPQLAHLTCFIDSNGSL
FT                   TQQGWDKVLPYLDGAMIDLKSWQSETHQWLVGRGNHRVFETINYLADKGKLHEVRLLHI
FT                   PNKSDLDIEVEQVGYYLKGLPSDVRIRLNAFQHHGVIGEALEWPKCTEQQMQSFHDKLY
FT                   LIVQRPMQTPEVYT"
     MARVKNNKTE KQAKVSRVLT FSCVDGPGNR LVLFLQGCNF DCITCHNPHT INHCNHCGDC        60
     VSGCPSSALS LIEGKVKWDP LACTNCDQCV DICDHKSSPK ITTMTVSDVL ELVRHNQFFL       120
     SGITVSGGEA TMQLPFIVEL FQAIKSDPQL AHLTCFIDSN GSLTQQGWDK VLPYLDGAMI       180
     DLKSWQSETH QWLVGRGNHR VFETINYLAD KGKLHEVRLL HIPNKSDLDI EVEQVGYYLK       240
     GLPSDVRIRL NAFQHHGVIG EALEWPKCTE QQMQSFHDKL YLIVQRPMQT PEVYT            295
//

If you have problems or comments...

PBIL Back to PBIL home page