(data stored in SCRATCH zone)

EMBL: FM954973.PE467

FM954973.PE467       Location/Qualifiers
FT   CDS             531090..532004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0475"
FT                   /product="putative Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25998"
FT                   /db_xref="GOA:B7VR90"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25998.1"
FT                   /translation="MTLILIASWSALLLYFLIHRSRQSKKLSSLIEMEAEFEGVKGVRS
FT                   VIDSQQFEESYKARLRKSYKKTIKVFQPNMSLKLILFASVTASVVYAVNEFFLRQDYFV
FT                   CLLLAEPILFFVFYSKLKQRQMNSFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDN
FT                   DVGKEFKLMAERLLIGEDPDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKI
FT                   NRLMFDSRAVEKKKNALTSEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPI
FT                   FYYVLVSELLGFFCIWLILRGVN"
     MTLILIASWS ALLLYFLIHR SRQSKKLSSL IEMEAEFEGV KGVRSVIDSQ QFEESYKARL        60
     RKSYKKTIKV FQPNMSLKLI LFASVTASVV YAVNEFFLRQ DYFVCLLLAE PILFFVFYSK       120
     LKQRQMNSFK TNFPDALNIL SGAISSGQSI IHAFEYVGKQ LDNDVGKEFK LMAERLLIGE       180
     DPDDVLERSS NTFPYLEYFF FASTIRINLA RGGQLKDVIN KINRLMFDSR AVEKKKNALT       240
     SEARASAKII ACLPVIFLII LKFTSPENYS FVMFEEAGQP IFYYVLVSEL LGFFCIWLIL       300
     RGVN                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page