(data stored in SCRATCH zone)

EMBL: FM954973.PE488

FM954973.PE488       Location/Qualifiers
FT   CDS             552642..553835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0497"
FT                   /product="Multidrug resistance protein mdtL"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26035"
FT                   /db_xref="GOA:B7VRB1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26035.1"
FT                   /translation="MSRRFDFKSILLACLVISIGQLSMGLVFPSLPWIAKDFDVSLEQA
FT                   QLLVSVYLLGFGPSQFIYGPISDALGRKKVLLSGLLIAMLGLLMIIFFSHSFTSMVMGR
FT                   FLQGLGTGCCAVLARASTRDRFSGADLPLAMSYIAMVASITPLIAPVIGGFINFHFGWS
FT                   MVFISLLGYVSLAWVVLAFKFKETVTQVSAIPSPKKMVSQYKELLTSRYFMSFASIGWL
FT                   NFSLMITTVSVMPFIMQNQIGMTSDEYAMWAVIPALGMLGGTSLCNRIRPMLGNKKTLL
FT                   CTPVLHIFAALWLFFCPLEPLYLMLGQFLMILGNGIALPCAQALVMLPYKKNAGAAAAM
FT                   SGGGQMVVSSMVSMGLVQLGLGEAWHLSLVIMLFTIITLINILRGFSSQEARESQLS"
     MSRRFDFKSI LLACLVISIG QLSMGLVFPS LPWIAKDFDV SLEQAQLLVS VYLLGFGPSQ        60
     FIYGPISDAL GRKKVLLSGL LIAMLGLLMI IFFSHSFTSM VMGRFLQGLG TGCCAVLARA       120
     STRDRFSGAD LPLAMSYIAM VASITPLIAP VIGGFINFHF GWSMVFISLL GYVSLAWVVL       180
     AFKFKETVTQ VSAIPSPKKM VSQYKELLTS RYFMSFASIG WLNFSLMITT VSVMPFIMQN       240
     QIGMTSDEYA MWAVIPALGM LGGTSLCNRI RPMLGNKKTL LCTPVLHIFA ALWLFFCPLE       300
     PLYLMLGQFL MILGNGIALP CAQALVMLPY KKNAGAAAAM SGGGQMVVSS MVSMGLVQLG       360
     LGEAWHLSLV IMLFTIITLI NILRGFSSQE ARESQLS                                397
//

If you have problems or comments...

PBIL Back to PBIL home page