(data stored in SCRATCH zone)

EMBL: FM954973.PE493

FM954973.PE493       Location/Qualifiers
FT   CDS             559194..560144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0502"
FT                   /product="ABC transporter: Substrate binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26044"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26044.1"
FT                   /translation="MNLQRIASHVSKIKSLHIKLAVSVLASALSFNAMADYQVEDSEGV
FT                   KTLEAQPVRVAALNWDIAEQVIELGVTPVAVPDIAGYTDWVVQPAIPEGVADIGTRTEP
FT                   NFSALKKLNPDVILIASPQKDLQDRLSEIAPVLYYQTYSEQHSNAAAAIENFKKIGQLL
FT                   GKEEQANNKLAVMDERIAVLKAELDKAYPGDKPKVTSFRFASTTSVFIYGDNSIPQYAL
FT                   EQLGFENAMDLPASQWGISQKRMTELKNVKKGIALYFEPFPYQEKLDRSPVWKSMPFVR
FT                   NGQFSPVAASWSYGGATSILYNAEAMAQSLLTLAE"
     MNLQRIASHV SKIKSLHIKL AVSVLASALS FNAMADYQVE DSEGVKTLEA QPVRVAALNW        60
     DIAEQVIELG VTPVAVPDIA GYTDWVVQPA IPEGVADIGT RTEPNFSALK KLNPDVILIA       120
     SPQKDLQDRL SEIAPVLYYQ TYSEQHSNAA AAIENFKKIG QLLGKEEQAN NKLAVMDERI       180
     AVLKAELDKA YPGDKPKVTS FRFASTTSVF IYGDNSIPQY ALEQLGFENA MDLPASQWGI       240
     SQKRMTELKN VKKGIALYFE PFPYQEKLDR SPVWKSMPFV RNGQFSPVAA SWSYGGATSI       300
     LYNAEAMAQS LLTLAE                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page