(data stored in SCRATCH zone)

EMBL: FM954973.PE503

FM954973.PE503       Location/Qualifiers
FT   CDS             complement(573132..581666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0512"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26063"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="InterPro:IPR041690"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26063.1"
FT                   /translation="MIKMANKKNVEANKKNTEIKNKKSNKLEQKKPTQKKKRRLHSHLK
FT                   VNIPLFQSLMMILPSLAKHAAAESIDNSSDAADQVTANNVTEKDVTDDHSKADSSAVAL
FT                   QEAQTSDSDINSTLSASHAAHGSSSHLVPSHHLSTLSHPQVHYIPSVSMPTISSGSNGQ
FT                   PTHSNAPTTPALPVSFMPEVIKGTYGELHVDANGQYTFVLNPNTPQYILLNQHQPGTDH
FT                   FALHLSNGSSIIVQIPVTGKQDTPNISGDLTGVVTEDHNIDSQGLLHANGKIDVIDPDQ
FT                   NQSSVTPEVISGKYGSLTIDADGHWQYQVDNSLSNVQALTAATSLHESFTIHTKDGTPQ
FT                   TIDMTIGGNDDNAVITGVDAGVVTEDLTTQVQGQLSVTDSDLGEDHFQASQVTSNFGTL
FT                   SITKDGAWTYNLDNNNPVVQKLGQGSTATDIVTVHSADGTAHQVMVTINGTNDHAVITS
FT                   STANSPSSFFAIGTSNGSSHVTEDKDLTVSGQLNITDIDSKEAHFSNSDLKGTLGTLHL
FT                   KDNGDWSYDLDNNKPQVQALGKGSSTTDIITVHSADGTPHQITITVNGTNDKAVISGTS
FT                   AGVVTEESQLQTSGILTVTDVDTGEAHFATSSTGSTDIAGSFGTLHLTDTGSWTYDLDN
FT                   TNPTVQALGKGATATDTITVQSADGTPHQVTITVNGTNGKAIIGGTNSGAVTEESQLQT
FT                   SGTLAVTDVDTGEAHFSNTDIVGSFGTLHLTDTGSWTYDLDNTNPTVQALGANKTATDT
FT                   ITVHSADGTPHQVTITVNGTNDAAVIGGTSAAAVTEETQLQTTGTLTITDTDGGEAHFA
FT                   NTDIQGTLGTLHLTDNGAWTYDLDNTNPAVQALGNGATTTDVITVNSADGTPHQITITV
FT                   NGTNDNAVVGGVDTASVTEKAAGDNMSPDHAQPGMATLRVSTLNANGHLSVVDPDSGQS
FT                   GFADNNVGYNYHGTYGDLILNPNGDWNYYADAGSLSHIGARPTTRGSAIDKLGEGETLT
FT                   DTITVHTKDGTPHNIVITINGSNDRPYCSSEVQLNAGTEDTRQTITAAALLQHSIDVDK
FT                   NDSGLLTVVNLHPDHGSILDNQDGTYTFTPEKDYNGKVHFSYDVKDAHGGVTHTGATTS
FT                   LSAVADKAVITGTDTGTIVEDHNVGPSSLQPVAASGLLSVTDPDAGQDHFQVNLLLGEQ
FT                   AIHDPFGGFLRITPSGAWGYEVANSRLQSLAEGEVEKVVYRVYSADHTAHDITITVTGT
FT                   NDKPTITATTLAHGTEDTHYQMQASQFGFSDIDTGDTLHSIAITGLPSATQGKFVLDGH
FT                   DVTAGQHIPTADISKLQFVPAQDFNGDVQFKYTVNDGHTDSAEATNTLHIDAVGDKAVI
FT                   SGVDTGDVHEGHTFTAPDGSMTGGYVDDRSPDHMHGNIGKLWNDEIHTDGHLSIVDADA
FT                   GESYAQTGVYYGSHGRVILQTNGDWSYFASIGQDVTGRAIDHLGKGESLTDTVTVKSAD
FT                   GTTHDIIITIHGDNDRPYCSGEVQLNSGKEDLAQTITASELLANTVDVDTNDAGQLTIA
FT                   NLHADHGTLVDNKDGTFTFTPDHDFNGKVHFTYDVKDAHGGVTHTGASATLLPSNDAAT
FT                   LQPTLASNFVTEDHLKSGTNTNELWSGWKNLDIQDIDSQPEAKVTQIEVNGVKHTVPAN
FT                   FAMNLAGTHGTFNFTHSTDGHDKWSYSADNSHAEVQSLSHGDSLTDTITLITADGTRIP
FT                   LTAKILGTDDHVIIDTPDALTAALGTAVEDKVTSISGTLLAHDSDSKDSVTFTAGNSVG
FT                   AYGTLHVDSNGQWHYDLDHSKANALQQGETKAEGFDITAISTDGSTATKHIEVLVQGND
FT                   DGAIISGQDSGQVTEDKHLQTSGNLTVTDPDSGEGHFTATSGSTQLGTYTIDASGHWTY
FT                   SLDPRVQSLHQGETTPDVFTVHSADGTAHVIKVTITGTQDAPIITGQSTGAVYEDSQTS
FT                   VSGTLNADDKDYGQSGFWAQSHIASTHNFGDLSIDRNGHWTFHLDPTNTAVNALGEHDT
FT                   LLETVTVNTIDGTSKEIQITIHGTNDGAIISGADTGSVTEDQFTGMQWLITKGQLTISD
FT                   ADTGEDKFDSMVHAQNNAGIGYDTKLGGHVLLSEDGSWQYNMDNFSPAVQKLAEGETAI
FT                   DTVTIHSVDGTPHEIQITITGTNDAPILGVNQTSSTTGTLTEADVDVNDTHTFSIVSST
FT                   GQFGSLSVDPNTGDYIYTPNTSITGMSYNSATNSYHGVDVFEVKVSDGHTEDSKFITFD
FT                   ASGHVTMSPTGGLVISTAVPQQPTVTTTLPTLLMVTNVAPTNSVTLNLASTSDSGSSNT
FT                   DNLTNDTTPTITGHTDIPFSKVTIYDGSTPVGHEVSDASGQYSVAVSSLSEGDHNLSAK
FT                   ALAPSSVLPATSSLLSVHIDTQVHVGIQTDPITADNVINAQESSSSIDITGSVSGDFNA
FT                   GDIVTLDVNGTQHTGVVDAKGHYSIAVPGSELIADADQKIEASVAVTDSAGNSAHATAD
FT                   VTYQVDTQVSVPTITFENAGADNLYSKAEIARGQANTITATVTPPGDAKIGEHLVVNGQ
FT                   DHVLDAHTLQHGIQIEVHPGSNVQATMTDEHGNTAGSQGFAASAIPEPIIVRPPSGSHQ
FT                   VSGTLGVPPLLPSLTPVPTAQSGWRIHLPNGQYVTSHHGQYGTLTIDPQTGHLHYQEQA
FT                   QVHTGPHGSASGIGQHEDKFEVALQGTNQDEVVAHVNIQILSHGPGNSGKLTVGTEVVD
FT                   MTITPVVHTSHPAPPPPPPVQHDEPDMASQADFTVTLSDDSNLDLTQQTHQEPEQKTSH
FT                   HGAAAYLDALGIKPDATSTTVHDQPADMDIVLAQVDQQDATTHDQAHLDMSDALEHHDA
FT                   NINHNQDDEHHHHNDVDGLPDIDPNS"
     MIKMANKKNV EANKKNTEIK NKKSNKLEQK KPTQKKKRRL HSHLKVNIPL FQSLMMILPS        60
     LAKHAAAESI DNSSDAADQV TANNVTEKDV TDDHSKADSS AVALQEAQTS DSDINSTLSA       120
     SHAAHGSSSH LVPSHHLSTL SHPQVHYIPS VSMPTISSGS NGQPTHSNAP TTPALPVSFM       180
     PEVIKGTYGE LHVDANGQYT FVLNPNTPQY ILLNQHQPGT DHFALHLSNG SSIIVQIPVT       240
     GKQDTPNISG DLTGVVTEDH NIDSQGLLHA NGKIDVIDPD QNQSSVTPEV ISGKYGSLTI       300
     DADGHWQYQV DNSLSNVQAL TAATSLHESF TIHTKDGTPQ TIDMTIGGND DNAVITGVDA       360
     GVVTEDLTTQ VQGQLSVTDS DLGEDHFQAS QVTSNFGTLS ITKDGAWTYN LDNNNPVVQK       420
     LGQGSTATDI VTVHSADGTA HQVMVTINGT NDHAVITSST ANSPSSFFAI GTSNGSSHVT       480
     EDKDLTVSGQ LNITDIDSKE AHFSNSDLKG TLGTLHLKDN GDWSYDLDNN KPQVQALGKG       540
     SSTTDIITVH SADGTPHQIT ITVNGTNDKA VISGTSAGVV TEESQLQTSG ILTVTDVDTG       600
     EAHFATSSTG STDIAGSFGT LHLTDTGSWT YDLDNTNPTV QALGKGATAT DTITVQSADG       660
     TPHQVTITVN GTNGKAIIGG TNSGAVTEES QLQTSGTLAV TDVDTGEAHF SNTDIVGSFG       720
     TLHLTDTGSW TYDLDNTNPT VQALGANKTA TDTITVHSAD GTPHQVTITV NGTNDAAVIG       780
     GTSAAAVTEE TQLQTTGTLT ITDTDGGEAH FANTDIQGTL GTLHLTDNGA WTYDLDNTNP       840
     AVQALGNGAT TTDVITVNSA DGTPHQITIT VNGTNDNAVV GGVDTASVTE KAAGDNMSPD       900
     HAQPGMATLR VSTLNANGHL SVVDPDSGQS GFADNNVGYN YHGTYGDLIL NPNGDWNYYA       960
     DAGSLSHIGA RPTTRGSAID KLGEGETLTD TITVHTKDGT PHNIVITING SNDRPYCSSE      1020
     VQLNAGTEDT RQTITAAALL QHSIDVDKND SGLLTVVNLH PDHGSILDNQ DGTYTFTPEK      1080
     DYNGKVHFSY DVKDAHGGVT HTGATTSLSA VADKAVITGT DTGTIVEDHN VGPSSLQPVA      1140
     ASGLLSVTDP DAGQDHFQVN LLLGEQAIHD PFGGFLRITP SGAWGYEVAN SRLQSLAEGE      1200
     VEKVVYRVYS ADHTAHDITI TVTGTNDKPT ITATTLAHGT EDTHYQMQAS QFGFSDIDTG      1260
     DTLHSIAITG LPSATQGKFV LDGHDVTAGQ HIPTADISKL QFVPAQDFNG DVQFKYTVND      1320
     GHTDSAEATN TLHIDAVGDK AVISGVDTGD VHEGHTFTAP DGSMTGGYVD DRSPDHMHGN      1380
     IGKLWNDEIH TDGHLSIVDA DAGESYAQTG VYYGSHGRVI LQTNGDWSYF ASIGQDVTGR      1440
     AIDHLGKGES LTDTVTVKSA DGTTHDIIIT IHGDNDRPYC SGEVQLNSGK EDLAQTITAS      1500
     ELLANTVDVD TNDAGQLTIA NLHADHGTLV DNKDGTFTFT PDHDFNGKVH FTYDVKDAHG      1560
     GVTHTGASAT LLPSNDAATL QPTLASNFVT EDHLKSGTNT NELWSGWKNL DIQDIDSQPE      1620
     AKVTQIEVNG VKHTVPANFA MNLAGTHGTF NFTHSTDGHD KWSYSADNSH AEVQSLSHGD      1680
     SLTDTITLIT ADGTRIPLTA KILGTDDHVI IDTPDALTAA LGTAVEDKVT SISGTLLAHD      1740
     SDSKDSVTFT AGNSVGAYGT LHVDSNGQWH YDLDHSKANA LQQGETKAEG FDITAISTDG      1800
     STATKHIEVL VQGNDDGAII SGQDSGQVTE DKHLQTSGNL TVTDPDSGEG HFTATSGSTQ      1860
     LGTYTIDASG HWTYSLDPRV QSLHQGETTP DVFTVHSADG TAHVIKVTIT GTQDAPIITG      1920
     QSTGAVYEDS QTSVSGTLNA DDKDYGQSGF WAQSHIASTH NFGDLSIDRN GHWTFHLDPT      1980
     NTAVNALGEH DTLLETVTVN TIDGTSKEIQ ITIHGTNDGA IISGADTGSV TEDQFTGMQW      2040
     LITKGQLTIS DADTGEDKFD SMVHAQNNAG IGYDTKLGGH VLLSEDGSWQ YNMDNFSPAV      2100
     QKLAEGETAI DTVTIHSVDG TPHEIQITIT GTNDAPILGV NQTSSTTGTL TEADVDVNDT      2160
     HTFSIVSSTG QFGSLSVDPN TGDYIYTPNT SITGMSYNSA TNSYHGVDVF EVKVSDGHTE      2220
     DSKFITFDAS GHVTMSPTGG LVISTAVPQQ PTVTTTLPTL LMVTNVAPTN SVTLNLASTS      2280
     DSGSSNTDNL TNDTTPTITG HTDIPFSKVT IYDGSTPVGH EVSDASGQYS VAVSSLSEGD      2340
     HNLSAKALAP SSVLPATSSL LSVHIDTQVH VGIQTDPITA DNVINAQESS SSIDITGSVS      2400
     GDFNAGDIVT LDVNGTQHTG VVDAKGHYSI AVPGSELIAD ADQKIEASVA VTDSAGNSAH      2460
     ATADVTYQVD TQVSVPTITF ENAGADNLYS KAEIARGQAN TITATVTPPG DAKIGEHLVV      2520
     NGQDHVLDAH TLQHGIQIEV HPGSNVQATM TDEHGNTAGS QGFAASAIPE PIIVRPPSGS      2580
     HQVSGTLGVP PLLPSLTPVP TAQSGWRIHL PNGQYVTSHH GQYGTLTIDP QTGHLHYQEQ      2640
     AQVHTGPHGS ASGIGQHEDK FEVALQGTNQ DEVVAHVNIQ ILSHGPGNSG KLTVGTEVVD      2700
     MTITPVVHTS HPAPPPPPPV QHDEPDMASQ ADFTVTLSDD SNLDLTQQTH QEPEQKTSHH      2760
     GAAAYLDALG IKPDATSTTV HDQPADMDIV LAQVDQQDAT THDQAHLDMS DALEHHDANI      2820
     NHNQDDEHHH HNDVDGLPDI DPNS                                             2844
//

If you have problems or comments...

PBIL Back to PBIL home page