(data stored in SCRATCH zone)

EMBL: FM954973.PE522

FM954973.PE522       Location/Qualifiers
FT   CDS             complement(601231..602031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0533"
FT                   /product="ABC transporter: transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26094"
FT                   /db_xref="GOA:B7VRE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26094.1"
FT                   /translation="MMLIRIIKPALSALVQIVVLVAAVVWILDSGAQTMGYSWQWERVP
FT                   DYIAFYEDGEWWPAELVEGLLVTINISLISLVATLIIGLTTALLRNSNSVVGRTLATSY
FT                   VELIRNTPLLVQIYLLYFVFGPVLGLDRFSTAVLALALFQGAYTAEIFRAGLNGIARGQ
FT                   FEAAQSLGLSKTYTYWDVILPQVVQRTLPPLTNEVISLIKNSSIVSVMAIFDLTTEARN
FT                   IVSETAMPFEIWFSVAIIYLALTLSLSAVAAWLEHKLGANWRTQ"
     MMLIRIIKPA LSALVQIVVL VAAVVWILDS GAQTMGYSWQ WERVPDYIAF YEDGEWWPAE        60
     LVEGLLVTIN ISLISLVATL IIGLTTALLR NSNSVVGRTL ATSYVELIRN TPLLVQIYLL       120
     YFVFGPVLGL DRFSTAVLAL ALFQGAYTAE IFRAGLNGIA RGQFEAAQSL GLSKTYTYWD       180
     VILPQVVQRT LPPLTNEVIS LIKNSSIVSV MAIFDLTTEA RNIVSETAMP FEIWFSVAII       240
     YLALTLSLSA VAAWLEHKLG ANWRTQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page