(data stored in SCRATCH zone)

EMBL: FM954973.PE542

FM954973.PE542       Location/Qualifiers
FT   CDS             625084..625464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0553"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26129"
FT                   /db_xref="GOA:B7VRG5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26129.1"
FT                   /translation="MILKKGGNMSTVVSVLLVVFFLLASSIKTIAWQKKVFEIQLGFFK
FT                   SYGLNRVIMFLVGMVEFTGAVLLLCALVGLAPEHTQLMGGLILASTSLGAIYFHLRFDT
FT                   WKDGIPAMVTLLGSSFLVIASY"
     MILKKGGNMS TVVSVLLVVF FLLASSIKTI AWQKKVFEIQ LGFFKSYGLN RVIMFLVGMV        60
     EFTGAVLLLC ALVGLAPEHT QLMGGLILAS TSLGAIYFHL RFDTWKDGIP AMVTLLGSSF       120
     LVIASY                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page