(data stored in SCRATCH zone)

EMBL: FM954973.PE558

FM954973.PE558       Location/Qualifiers
FT   CDS             641777..642274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26156"
FT                   /db_xref="GOA:B7VRI1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26156.1"
FT                   /translation="MMIGELAGVAVVSIAAVLGIASIMLNYPWLFTGFKFVGAAYLFYL
FT                   GVQMWRSRGKLAISTDNQTTKVSNDWDLVVQGFVTAIANPKGWAFMISLLPPFINSNKD
FT                   LAPQLLILVSIILFSEFVCMTLYATGGKSLKHMLGKADNVKLMNRIAGTLMMGVGVWLF
FT                   VS"
     MMIGELAGVA VVSIAAVLGI ASIMLNYPWL FTGFKFVGAA YLFYLGVQMW RSRGKLAIST        60
     DNQTTKVSND WDLVVQGFVT AIANPKGWAF MISLLPPFIN SNKDLAPQLL ILVSIILFSE       120
     FVCMTLYATG GKSLKHMLGK ADNVKLMNRI AGTLMMGVGV WLFVS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page