(data stored in SCRATCH zone)

EMBL: FM954973.PE559

FM954973.PE559       Location/Qualifiers
FT   CDS             complement(642526..644553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0570"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26158"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26158.1"
FT                   /translation="MSKETFDSTRFNKSNNKPFEEVLDANLSRRNVLKGGLGISAMTAF
FT                   GAFGLAGHSTANAATMQATSAQKSTATLAFESVKGSLTDSVVVPKGYTAQVLVPWGTPL
FT                   NKQGKAWLKDGTNNAQDQANSLGMHHDGMHFFPLDGNSNDGLLVINHEYIDQKALHTNG
FT                   PTYDEGNRPSLDEVRKEINAHGVSVVRVKLEGNQWVMVDNDPLNRRYTGATVIDLSGPV
FT                   AHSEFAKTKFSQDGSQARGTLNNCGNGYTPWGTYLTCEENWPGYFVNKGETTPAQERIG
FT                   IATDKTRYGWDTLSGNKQQRLDEFARFDVTPSADSPIDDYRNEAHGHGYIVEIDPYTAN
FT                   SRAKKRSALGCFRHEGCTFGKLTEGEPIVFYSGHDSRFEYLYKFVSEAKWDPRDAEPSN
FT                   RLSVGDKYMDKGTLYVAKFNDDGSGTWLPLTLSSKTTNGGKLGDSFDSQAALIINTAGA
FT                   ADLVGATPMDRPEWCSVDPMTGTAYLTLTNNNKRKEANSANPRVDNKFGHVIRWDEGKT
FT                   AGEFDWDIFVFGSPAVDDKSINRSGLTDMNQFASPDGLAFDARGILWIQTDNGADEVTG
FT                   YTNDQMLAVVPSQLTDDNGNSAVIDANNQAQLKRFFVGPNGCEVTGFTISPDFKSLFVN
FT                   IQHPANWPSSQDATAQTQGNVRPRASTVVIRREDGGEIAV"
     MSKETFDSTR FNKSNNKPFE EVLDANLSRR NVLKGGLGIS AMTAFGAFGL AGHSTANAAT        60
     MQATSAQKST ATLAFESVKG SLTDSVVVPK GYTAQVLVPW GTPLNKQGKA WLKDGTNNAQ       120
     DQANSLGMHH DGMHFFPLDG NSNDGLLVIN HEYIDQKALH TNGPTYDEGN RPSLDEVRKE       180
     INAHGVSVVR VKLEGNQWVM VDNDPLNRRY TGATVIDLSG PVAHSEFAKT KFSQDGSQAR       240
     GTLNNCGNGY TPWGTYLTCE ENWPGYFVNK GETTPAQERI GIATDKTRYG WDTLSGNKQQ       300
     RLDEFARFDV TPSADSPIDD YRNEAHGHGY IVEIDPYTAN SRAKKRSALG CFRHEGCTFG       360
     KLTEGEPIVF YSGHDSRFEY LYKFVSEAKW DPRDAEPSNR LSVGDKYMDK GTLYVAKFND       420
     DGSGTWLPLT LSSKTTNGGK LGDSFDSQAA LIINTAGAAD LVGATPMDRP EWCSVDPMTG       480
     TAYLTLTNNN KRKEANSANP RVDNKFGHVI RWDEGKTAGE FDWDIFVFGS PAVDDKSINR       540
     SGLTDMNQFA SPDGLAFDAR GILWIQTDNG ADEVTGYTND QMLAVVPSQL TDDNGNSAVI       600
     DANNQAQLKR FFVGPNGCEV TGFTISPDFK SLFVNIQHPA NWPSSQDATA QTQGNVRPRA       660
     STVVIRREDG GEIAV                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page