(data stored in SCRATCH zone)

EMBL: FM954973.PE578

FM954973.PE578       Location/Qualifiers
FT   CDS             complement(659861..661168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0589"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26194"
FT                   /db_xref="GOA:B7VRK1"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26194.1"
FT                   /translation="MSMKKSFPIRGHLTTFFLGLSLLTALLFGELLIRHFEYGIEDSVK
FT                   MRLASEWLSFNEVRLINPEAKLPKSYVVSFYYDQLPNIKVDGKDVLRDVTFVNDEFTVV
FT                   FVDETVTNDIKKEAVFGVYRFALEDGRLVFGVARYDYRLIGDTIDVWFDHRFNLIIYIA
FT                   LGYIFFIVLALWLYSYRVGKKTEQLVEWSESASNDLLANPAPNFKFSEYNRVALYLEKA
FT                   LSKNAHLVEREQRFLSHASHELRTPIAIIRANMEILERISLPSDLQRPINRIDRASSNM
FT                   QQITETMLWLVRKSETPPNQSLVSVVALLDNLIEELEYLIQGEESDIIRNYLHAPTVEL
FT                   PETPIKIVVGNLIRNAFQYTHSGTIHIYFEKNSIVIKNINTQELDLPFQDSFGLGQDLT
FT                   EKICKKLGWHLEAEEIEGGLLARLHLPVEEKSNTNA"
     MSMKKSFPIR GHLTTFFLGL SLLTALLFGE LLIRHFEYGI EDSVKMRLAS EWLSFNEVRL        60
     INPEAKLPKS YVVSFYYDQL PNIKVDGKDV LRDVTFVNDE FTVVFVDETV TNDIKKEAVF       120
     GVYRFALEDG RLVFGVARYD YRLIGDTIDV WFDHRFNLII YIALGYIFFI VLALWLYSYR       180
     VGKKTEQLVE WSESASNDLL ANPAPNFKFS EYNRVALYLE KALSKNAHLV EREQRFLSHA       240
     SHELRTPIAI IRANMEILER ISLPSDLQRP INRIDRASSN MQQITETMLW LVRKSETPPN       300
     QSLVSVVALL DNLIEELEYL IQGEESDIIR NYLHAPTVEL PETPIKIVVG NLIRNAFQYT       360
     HSGTIHIYFE KNSIVIKNIN TQELDLPFQD SFGLGQDLTE KICKKLGWHL EAEEIEGGLL       420
     ARLHLPVEEK SNTNA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page