(data stored in SCRATCH zone)

EMBL: FM954973.PE58

FM954973.PE58        Location/Qualifiers
FT   CDS             73265..74107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0060"
FT                   /product="ABC transporter: transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25283"
FT                   /db_xref="GOA:B7VQ31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25283.1"
FT                   /translation="MNFITENKIPVGQWMEAGVDWLTINAAGFFDAISIFLETVIMFLV
FT                   DVFKWMPPALPIVITAAIAWYLHRKPSLVIFVVAALLTILNLGYWQEMLETFVLVFAAT
FT                   TISVLIGVPVGIMAAHRPWLYTVLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTI
FT                   IFAIAAPIRLTYLGVTKVPEELIEAGKAFGASRMKLLMKVELPAALPSIMAGVTQCIML
FT                   SLSMVVIAALVGADGLGKPVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPNQKEA"
     MNFITENKIP VGQWMEAGVD WLTINAAGFF DAISIFLETV IMFLVDVFKW MPPALPIVIT        60
     AAIAWYLHRK PSLVIFVVAA LLTILNLGYW QEMLETFVLV FAATTISVLI GVPVGIMAAH       120
     RPWLYTVLRP ILDLMQTVPT FVYLIPTLVL FGLGIVPGLI STIIFAIAAP IRLTYLGVTK       180
     VPEELIEAGK AFGASRMKLL MKVELPAALP SIMAGVTQCI MLSLSMVVIA ALVGADGLGK       240
     PVVRALNTVN ISQGFEAGLA IVLVAIILDR LCKTPNQKEA                             280
//

If you have problems or comments...

PBIL Back to PBIL home page