(data stored in SCRATCH zone)

EMBL: FM954973.PE586

FM954973.PE586       Location/Qualifiers
FT   CDS             complement(670239..670700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0597"
FT                   /product="cytochrome c-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26207"
FT                   /db_xref="GOA:B7VRK9"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26207.1"
FT                   /translation="MKKLITALLSAGLLLAGAVQAQAELDNPGGIGGVESLRGASELEA
FT                   TRAADDFKKFPRDQVLESDYVYQPPLVPHTIRSYEVSLNANKCLACHSWKNAKEMGATK
FT                   VSVTHYMNREDAVLADVSPRRYFCLQCHVPQANAKPLVENEFKPVDSLR"
     MKKLITALLS AGLLLAGAVQ AQAELDNPGG IGGVESLRGA SELEATRAAD DFKKFPRDQV        60
     LESDYVYQPP LVPHTIRSYE VSLNANKCLA CHSWKNAKEM GATKVSVTHY MNREDAVLAD       120
     VSPRRYFCLQ CHVPQANAKP LVENEFKPVD SLR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page