(data stored in SCRATCH zone)

EMBL: FM954973.PE623

FM954973.PE623       Location/Qualifiers
FT   CDS             complement(709918..710604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26274"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26274.1"
FT                   /translation="MRRYIFGGFISCFLCGQALGITLFPTVIELNTDHRATSQLVVTNN
FT                   STRDLPLEANVRRLKFLPDGTFQTIDLSSEVMFVFPPAAMLAPGERQVFRIQWLGNRQL
FT                   ETSQSYFVRFSTLNIGQNNEKMDSPTSLTTGINLQVHYNALLHIHSSSLEPDVNLHIDE
FT                   QGKLTLTNSGSRFTYTSLLHFKGLESQNQKVHEALGEQFIPPRSTITLPSSLNYLPVGT
FT                   YHGYEN"
     MRRYIFGGFI SCFLCGQALG ITLFPTVIEL NTDHRATSQL VVTNNSTRDL PLEANVRRLK        60
     FLPDGTFQTI DLSSEVMFVF PPAAMLAPGE RQVFRIQWLG NRQLETSQSY FVRFSTLNIG       120
     QNNEKMDSPT SLTTGINLQV HYNALLHIHS SSLEPDVNLH IDEQGKLTLT NSGSRFTYTS       180
     LLHFKGLESQ NQKVHEALGE QFIPPRSTIT LPSSLNYLPV GTYHGYEN                    228
//

If you have problems or comments...

PBIL Back to PBIL home page