(data stored in SCRATCH zone)

EMBL: FM954973.PE624

FM954973.PE624       Location/Qualifiers
FT   CDS             complement(710607..711347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0635"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26276"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26276.1"
FT                   /translation="MELIAMYKWIMHKWTVLLLLSLTCLSAHAFKVEPMSMEMTPLGKR
FT                   AQMTMRVENSSTEPLTVELSPVFMTMNEYGKETTTPADDELLVIPVTAIIEPGRSQSIM
FT                   VRYLGDPSITESKAFRIAVKQVKVQRASSNQGQVSLLLQFNTLINVRPQNTASQLEIKS
FT                   IEPNNKNNKWVLEVLNSGNSYGRLTNTTWKISDGKKSTYLKGVEIAKRIPGTLVLPYST
FT                   RFFEMQPLENYNVETLSIEIEQDQ"
     MELIAMYKWI MHKWTVLLLL SLTCLSAHAF KVEPMSMEMT PLGKRAQMTM RVENSSTEPL        60
     TVELSPVFMT MNEYGKETTT PADDELLVIP VTAIIEPGRS QSIMVRYLGD PSITESKAFR       120
     IAVKQVKVQR ASSNQGQVSL LLQFNTLINV RPQNTASQLE IKSIEPNNKN NKWVLEVLNS       180
     GNSYGRLTNT TWKISDGKKS TYLKGVEIAK RIPGTLVLPY STRFFEMQPL ENYNVETLSI       240
     EIEQDQ                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page