(data stored in SCRATCH zone)

EMBL: FM954973.PE637

FM954973.PE637       Location/Qualifiers
FT   CDS             726718..727302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0658"
FT                   /product="arsenite-oxidase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26300"
FT                   /db_xref="GOA:B7VRR0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014067"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26300.1"
FT                   /translation="MNANSEQNSSKRHNKCMMSRRDFLLYSGAATAVSMVPLTLFAGTD
FT                   SETQVEGRIVGYPRKKIAKLSQLSNHIPVHFQYPDEGKNSIAMLVKSDIECGGGIGLQR
FT                   DIVAYSMTCTHQGGPLTGAYKATGEHRIVGQCPFHLSTFDLRRHGIMVSGQAFESLPQV
FT                   LLELEGDDIYAVGVMGLIFGRMENLIDVEVS"
     MNANSEQNSS KRHNKCMMSR RDFLLYSGAA TAVSMVPLTL FAGTDSETQV EGRIVGYPRK        60
     KIAKLSQLSN HIPVHFQYPD EGKNSIAMLV KSDIECGGGI GLQRDIVAYS MTCTHQGGPL       120
     TGAYKATGEH RIVGQCPFHL STFDLRRHGI MVSGQAFESL PQVLLELEGD DIYAVGVMGL       180
     IFGRMENLID VEVS                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page