(data stored in SCRATCH zone)

EMBL: FM954973.PE644

FM954973.PE644       Location/Qualifiers
FT   CDS             733589..733750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26313"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26313.1"
FT                   /translation="MALFNAPLSSGINKTCYAIMLQMSRYARGSEVFRYSKHNKMIGLP
FT                   IPNPSIFK"
     MALFNAPLSS GINKTCYAIM LQMSRYARGS EVFRYSKHNK MIGLPIPNPS IFK               53
//

If you have problems or comments...

PBIL Back to PBIL home page