(data stored in SCRATCH zone)

EMBL: FM954973.PE648

FM954973.PE648       Location/Qualifiers
FT   CDS             738157..738480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0669"
FT                   /product="Nitrite reductase (NAD(P)H), small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26321"
FT                   /db_xref="GOA:B7VRS1"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26321.1"
FT                   /translation="MAFTKVCKIEDIIPGTGVCALVGGEQVAIFRPTKAEEVFAISNTD
FT                   PFFQSNVLSRGLTVEHKGELWVASPLKKQRFNLATGVCMEDESFSVKAYKARVTKGAVE
FT                   VSA"
     MAFTKVCKIE DIIPGTGVCA LVGGEQVAIF RPTKAEEVFA ISNTDPFFQS NVLSRGLTVE        60
     HKGELWVASP LKKQRFNLAT GVCMEDESFS VKAYKARVTK GAVEVSA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page