(data stored in ACNUC8465 zone)

EMBL: FN543502.AATA

FN543502.AATA        Location/Qualifiers
FT   CDS             375174..376382
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="ROD_03461"
FT                   /product="AatA, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87128"
FT                   /db_xref="GOA:D2TJZ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ8"
FT                   /protein_id="CBG87128.1"
FT                   /translation="MRFNKKYMVIILANLLVGKDVFSCSLNMYLSKLESYELFKLEQED
FT                   SLLQNKSVASSFLPNVSIGMGQYINNNTGLVDIGRSSFYIAASQLIFSGESLGKNSEKE
FT                   ENDNKRRIISFEKDKNEQLLKLYADILQYKYLKENISLILRRLDKLKLEYNKTVLDLKS
FT                   GIIPSLEVDVKSLNVLKMESSLNRLKADYELLENKINKNYSIPPQNISKITENDILSCK
FT                   TISYRELIDKNKHNKLQQADIELDINNASLLPSIYLSIGLTPKNEGALRDINLREMNYN
FT                   GGISVNFPINNIFSAIDNQKKYAISVTKARLESERDHEQLLIANRNILNEYLAIKRNIP
FT                   ILKKEVQLKNRRMEYKLWLVKEKKENILSYLDSQDELYEAEINLKKNERDLKYYQMYLN
FT                   FIN"
     MRFNKKYMVI ILANLLVGKD VFSCSLNMYL SKLESYELFK LEQEDSLLQN KSVASSFLPN        60
     VSIGMGQYIN NNTGLVDIGR SSFYIAASQL IFSGESLGKN SEKEENDNKR RIISFEKDKN       120
     EQLLKLYADI LQYKYLKENI SLILRRLDKL KLEYNKTVLD LKSGIIPSLE VDVKSLNVLK       180
     MESSLNRLKA DYELLENKIN KNYSIPPQNI SKITENDILS CKTISYRELI DKNKHNKLQQ       240
     ADIELDINNA SLLPSIYLSI GLTPKNEGAL RDINLREMNY NGGISVNFPI NNIFSAIDNQ       300
     KKYAISVTKA RLESERDHEQ LLIANRNILN EYLAIKRNIP ILKKEVQLKN RRMEYKLWLV       360
     KEKKENILSY LDSQDELYEA EINLKKNERD LKYYQMYLNF IN                          402
//

If you have problems or comments...

PBIL Back to PBIL home page