(data stored in ACNUC8465 zone)

EMBL: FN543502.AATC

FN543502.AATC        Location/Qualifiers
FT   CDS             377111..377740
FT                   /transl_table=11
FT                   /gene="aatC"
FT                   /locus_tag="ROD_03481"
FT                   /product="AatC, ATP binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03481"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87130"
FT                   /db_xref="GOA:D2TK00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK00"
FT                   /protein_id="CBG87130.1"
FT                   /translation="MINLYIHKKKFRDKTILIDTSLKIMEGGFYIITGPSGVGKSSLLN
FT                   IIGLLDGDFYGDYMFYDEKIYFYDCNKTQELRRSYFGYIFQDSLINERQDLIRNILCSV
FT                   EYSKQKEKKKTVDHFLSMVGLHFKNGCSSVLSGGEKQRLALARALIKQPKILLADEPTA
FT                   SLDKENKKIIMSILNSFNNEGGTIIMVTHDLELINNNMEVITLSNC"
     MINLYIHKKK FRDKTILIDT SLKIMEGGFY IITGPSGVGK SSLLNIIGLL DGDFYGDYMF        60
     YDEKIYFYDC NKTQELRRSY FGYIFQDSLI NERQDLIRNI LCSVEYSKQK EKKKTVDHFL       120
     SMVGLHFKNG CSSVLSGGEK QRLALARALI KQPKILLADE PTASLDKENK KIIMSILNSF       180
     NNEGGTIIMV THDLELINNN MEVITLSNC                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page