(data stored in ACNUC8465 zone)

EMBL: FN543502.AATD

FN543502.AATD        Location/Qualifiers
FT   CDS             370190..371410
FT                   /transl_table=11
FT                   /gene="aatD"
FT                   /locus_tag="ROD_03431"
FT                   /product="putative membrane-spanning transport protein"
FT                   /note="Similar to AatD, part of the Aat transporter in
FT                   EAEC, note the different genomic location in relation to
FT                   the rest of the aat cluster homologues compared to p042"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87125"
FT                   /db_xref="GOA:D2TJZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ6"
FT                   /protein_id="CBG87125.1"
FT                   /translation="MIEAFIPTLSLILLLKCAMKKRLFVIVLYLIIFNIIFFIFVFGKG
FT                   SWGVIKTSYMLAPFALSLIINMQVVLAIYFREKGAGYVLLSSFFPPLFFSFWSFDLIMP
FT                   SHPLMIFYQFDELYKILPRFNKNIINIIIIYALPFFFLLPLRKSMLLIIIMLLMFFIRW
FT                   GLIEYEKLGIKVLVVQTGMFLSKHEEIVELRNEIFKYNNADIVIFSESPAIGFKEGSRT
FT                   AFTRELLDEIKGKNDGKLYILNNYGFVDDKKYNYNLSLYIMNGSMRIKAKNKLVPLWEV
FT                   PGLFYSKSDWDSPFFSVPSEKMIEQYKFRGLYINSYICYEAMFTKHNSDVNDLTIIQSN
FT                   YESFKKGYDRIVKNGNVLAYVNKSSSFKNFISVQNMGGTIFVDNTGKFHWDVYKKSLKQ
FT                   AIFLLEI"
     MIEAFIPTLS LILLLKCAMK KRLFVIVLYL IIFNIIFFIF VFGKGSWGVI KTSYMLAPFA        60
     LSLIINMQVV LAIYFREKGA GYVLLSSFFP PLFFSFWSFD LIMPSHPLMI FYQFDELYKI       120
     LPRFNKNIIN IIIIYALPFF FLLPLRKSML LIIIMLLMFF IRWGLIEYEK LGIKVLVVQT       180
     GMFLSKHEEI VELRNEIFKY NNADIVIFSE SPAIGFKEGS RTAFTRELLD EIKGKNDGKL       240
     YILNNYGFVD DKKYNYNLSL YIMNGSMRIK AKNKLVPLWE VPGLFYSKSD WDSPFFSVPS       300
     EKMIEQYKFR GLYINSYICY EAMFTKHNSD VNDLTIIQSN YESFKKGYDR IVKNGNVLAY       360
     VNKSSSFKNF ISVQNMGGTI FVDNTGKFHW DVYKKSLKQA IFLLEI                      406
//

If you have problems or comments...

PBIL Back to PBIL home page