(data stored in ACNUC8465 zone)

EMBL: FN543502.AFUA

FN543502.AFUA        Location/Qualifiers
FT   CDS             complement(456337..457368)
FT                   /transl_table=11
FT                   /gene="afuA"
FT                   /locus_tag="ROD_04061"
FT                   /product="ABC transporter periplasmic iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87188"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKU7"
FT                   /protein_id="CBG87188.1"
FT                   /translation="MKMTFTSTLIASAVALAALTGAAQAKGRLVVYCSATNELCEAQTK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQPYKSP
FT                   ALAQVMENFRDPAKLKGNYSSAVYVGILGFGVNTERLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFVQLWGDDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNARLFVDWVLSKEA
FT                   QELAWKKGKSYQILSNTTAETSPNSLKLDGLKLIHYDMDKYGSTEVRKALINKWVSDVK
FT                   MGK"
     MKMTFTSTLI ASAVALAALT GAAQAKGRLV VYCSATNELC EAQTKAFGEK YDVKTSFIRN        60
     GSGSTLAKVD AEKKNPQADV WYGGTLDPQS QAGEMGLLQP YKSPALAQVM ENFRDPAKLK       120
     GNYSSAVYVG ILGFGVNTER LKEKNLPVPK CWKDLTKPEY KGEIQIADPQ SSGTAYTALA       180
     TFVQLWGDDQ AFDYLKQLNA NVSQYTKSGI APARNAARGE TAIGIGFLHD YSLEKEQGAP       240
     LELISPCEGT GYEIGGVSIL KGARNLDNAR LFVDWVLSKE AQELAWKKGK SYQILSNTTA       300
     ETSPNSLKLD GLKLIHYDMD KYGSTEVRKA LINKWVSDVK MGK                         343
//

If you have problems or comments...

PBIL Back to PBIL home page