(data stored in ACNUC8465 zone)

EMBL: FN543502.AMPH

FN543502.AMPH        Location/Qualifiers
FT   CDS             complement(469575..470732)
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ROD_04171"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87199"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV8"
FT                   /protein_id="CBG87199.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVQAAQPIAEPVFASDIVERYANHIFYG
FT                   SGATGMALVVIDGNQRVFRSFGETRPGNNVRPQLDSVIRIASITKLMTSEMLVKLLDQG
FT                   TVRLDDPLSKYAPPGAYVPSYQGKPITLVHLATHTSALPREQPGGAPKRPVFVWPTREQ
FT                   RWTYLSDATLKAAPGSQASYSNLAYDLLADALANAAGKPYSQLFAEKITRPLGMKDTTF
FT                   TPSPDQCKRLMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSNQAD
FT                   RMQTLIYQRAQLTRVTGMDVPGKADALGLGWVYMAPKNGRPGIIQKTGGGGGFITYMAM
FT                   IPQQNVGAFVVVTRSPLTRFKNMSDGINDLVVELSENRPLAVPAS"
     MKRSLLFSAV LCAASLTSVQ AAQPIAEPVF ASDIVERYAN HIFYGSGATG MALVVIDGNQ        60
     RVFRSFGETR PGNNVRPQLD SVIRIASITK LMTSEMLVKL LDQGTVRLDD PLSKYAPPGA       120
     YVPSYQGKPI TLVHLATHTS ALPREQPGGA PKRPVFVWPT REQRWTYLSD ATLKAAPGSQ       180
     ASYSNLAYDL LADALANAAG KPYSQLFAEK ITRPLGMKDT TFTPSPDQCK RLMVAEKGAS       240
     PCNNTLAAIG SGGVYSTPGD MMRWMQQYLS SDFYHRSNQA DRMQTLIYQR AQLTRVTGMD       300
     VPGKADALGL GWVYMAPKNG RPGIIQKTGG GGGFITYMAM IPQQNVGAFV VVTRSPLTRF       360
     KNMSDGINDL VVELSENRPL AVPAS                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page