(data stored in ACNUC8465 zone)

EMBL: FN543502.AROL

FN543502.AROL        Location/Qualifiers
FT   CDS             483287..483775
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ROD_04321"
FT                   /product="shikimate kinase II"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04321"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87213"
FT                   /db_xref="GOA:D2TKX2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX2"
FT                   /protein_id="CBG87213.1"
FT                   /translation="MALAAAIDCRFVDTDQWLQSQAQMTVAEIVEREGWQGFRARETAA
FT                   LEAVTASATVVATGGGIILTPVNRHFMREHGTVIYLRAPVSILVNRLAASPEEALRPAL
FT                   TGKPLSEEVAEVLQQRDALYREAAHFIVDATGSPDQVISEIRHALAQTVQRKQGGVYT"
     MALAAAIDCR FVDTDQWLQS QAQMTVAEIV EREGWQGFRA RETAALEAVT ASATVVATGG        60
     GIILTPVNRH FMREHGTVIY LRAPVSILVN RLAASPEEAL RPALTGKPLS EEVAEVLQQR       120
     DALYREAAHF IVDATGSPDQ VISEIRHALA QTVQRKQGGV YT                          162
//

If you have problems or comments...

PBIL Back to PBIL home page