(data stored in ACNUC8465 zone)

EMBL: FN543502.BRNQ

FN543502.BRNQ        Location/Qualifiers
FT   CDS             497023..498342
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ROD_04451"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87225"
FT                   /db_xref="GOA:D2TKY4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY4"
FT                   /protein_id="CBG87225.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLFIYSVIYFALVILVSLYPGKLLDTVGNFLAPLKIIALIVLS
FT                   VAAIIWPAGPISHAMEAYENAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTESR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSVNGAAILHAYVQHTFGGAGSL
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRSLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPAMFISLLFGILDGIKASAIGDVLPAW
FT                   TQRLPLAEQGLAWLIPTVVIVVLAIIWDRAAGRQVTSGAH"
     MTHQLKSRDI IALGFMTFAL FVGAGNIIFP PMVGLQAGEH VWTAAFGFLI TAVGLPVLTV        60
     VALAKVGGGV DSLSTPIGKV AGVLLATVCY LAVGPLFATP RTATVSFEVG IAPLTGDSAM       120
     PLFIYSVIYF ALVILVSLYP GKLLDTVGNF LAPLKIIALI VLSVAAIIWP AGPISHAMEA       180
     YENAAFSNGF VNGYLTMDTL GAMVFGIVIV NAARSRGVTE SRLLTRYTVW AGLMAGVGLT       240
     LLYLALFRLG SDSATLVDQS VNGAAILHAY VQHTFGGAGS LLLAALIFIA CLVTAVGLTC       300
     ACAEFFAQYV PLSYRSLVFI LGGFSMVVSN LGLSHLIQIS IPVLTAIYPP CIALVVLSFT       360
     RSWWHNSSRV IAPAMFISLL FGILDGIKAS AIGDVLPAWT QRLPLAEQGL AWLIPTVVIV       420
     VLAIIWDRAA GRQVTSGAH                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page