(data stored in ACNUC8465 zone)

EMBL: FN543502.BTUF

FN543502.BTUF        Location/Qualifiers
FT   CDS             complement(193672..194472)
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ROD_01621"
FT                   /product="vitamin B12-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86942"
FT                   /db_xref="GOA:D2TI46"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI46"
FT                   /protein_id="CBG86942.1"
FT                   /translation="MANSLSRALAALLLWLPVSLCAAPRVITLSPANTELAFAAGITPV
FT                   AVSSYSDYPPAARDIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVNQLTSLGIRV
FT                   MWVDAASIEQIAQTLRKLAAWSPQPEKAQHAARRLLDDYQQLKSEYADRSKKRLFLQFG
FT                   INPPFTSAKGSIQNEVLELCGGENIFADSRVPWPQVSREQVLARAPQAIVVAGNAEETL
FT                   KIKQYWGNQLKIPVIPLTSDWFERASPRIILAAKQLCTALSQVN"
     MANSLSRALA ALLLWLPVSL CAAPRVITLS PANTELAFAA GITPVAVSSY SDYPPAARDI        60
     EQVSTWQGMN LERIVALKPD LVIAWRGGNA ERQVNQLTSL GIRVMWVDAA SIEQIAQTLR       120
     KLAAWSPQPE KAQHAARRLL DDYQQLKSEY ADRSKKRLFL QFGINPPFTS AKGSIQNEVL       180
     ELCGGENIFA DSRVPWPQVS REQVLARAPQ AIVVAGNAEE TLKIKQYWGN QLKIPVIPLT       240
     SDWFERASPR IILAAKQLCT ALSQVN                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page