(data stored in ACNUC8465 zone)

EMBL: FN543502.CRL

FN543502.CRL         Location/Qualifiers
FT   CDS             359230..359631
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="ROD_03351"
FT                   /product="sigma factor-binding protein crl (curlin genes
FT                   transcriptional activator)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87117"
FT                   /db_xref="GOA:D2TJY9"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY9"
FT                   /protein_id="CBG87117.1"
FT                   /translation="MTLPCGHPRSRLIKKFTALGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPELREFWGWWMELEAQENRFTYSYKFGLFDKAGDWTAVPIKDAEVVERLEHTLREFH
FT                   EKLRELLNSLELSLEPADDFTDEPVKLSA"
     MTLPCGHPRS RLIKKFTALG PYIREGKCED NRFFFDCLAV CVNVKPAPEL REFWGWWMEL        60
     EAQENRFTYS YKFGLFDKAG DWTAVPIKDA EVVERLEHTL REFHEKLREL LNSLELSLEP       120
     ADDFTDEPVK LSA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page