(data stored in ACNUC8465 zone)

EMBL: FN543502.DNAK

FN543502.DNAK        Location/Qualifiers
FT   CDS             11731..13647
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ROD_00101"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86789"
FT                   /db_xref="GOA:D2TGJ0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ0"
FT                   /protein_id="CBG86789.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRMINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   EAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDQLPADDKTAIESALSALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
     MGKIIGIDLG TTNSCVAIMD GTQARVLENA EGDRTTPSII AYTQDGETLV GQPAKRQAVT        60
     NPQNTLFAIK RLIGRRFQDE EVQRDVSIMP YKIIGADNGD AWLDVKGQKM APPQISAEVL       120
     KKMKKTAEDY LGEPVTEAVI TVPAYFNDAQ RQATKDAGRI AGLEVKRIIN EPTAAALAYG       180
     LDKEVGNRTI AVYDLGGGTF DISIIEIDEV DGEKTFEVLA TNGDTHLGGE DFDSRMINYL       240
     VEEFKKDQGI DLRNDPLAMQ RLKEAAEKAK IELSSAQQTD VNLPYITADA TGPKHMNIKV       300
     TRAKLESLVE DLVNRSIEPL KVALQDAGLS VSDINDVILV GGQTRMPMVQ KKVAEFFGKE       360
     PRKDVNPDEA VAIGAAVQGG VLTGDVKDVL LLDVTPLSLG IETMGGVMTA LISKNTTIPT       420
     KHSQVFSTAE DNQSAVTIHV LQGERKRASD NKSLGQFNLD GINPAPRGMP QIEVTFDIDA       480
     DGILHVSAKD KNSGKEQKIT IKASSGLNEE EIQKMVREAE ANAESDRKFE ELVQTRNQGD       540
     HLLHSTRKQV EEAGDQLPAD DKTAIESALS ALETALKGED KAAIEAKMQE LAQVSQKLME       600
     IAQQQHAQQQ AGSADASANN AKDDDVVDAE FEEVKDKK                               638
//

If you have problems or comments...

PBIL Back to PBIL home page