(data stored in ACNUC8465 zone)

EMBL: FN543502.DNAQ

FN543502.DNAQ        Location/Qualifiers
FT   CDS             265219..265950
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ROD_02201"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87000"
FT                   /db_xref="GOA:D2TIZ8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2TIZ8"
FT                   /protein_id="CBG87000.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHIYLKPDRLVDPEAFGVHGIADEFLLDKPTFADVADEFLDYIRGAELVIHNASFDI
FT                   GFMDYEFSKLNRDIPKTSSFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHG
FT                   ALLDAQILADVYLAMTGGQTSMTFAMEGETQQQQGEETIQRLVRQARKLRVVFASDEEV
FT                   AAHEARLDLVEKKGGSCLWRA"
     MSTAITRQIV LDTETTGMNQ IGAHYEGHKI IEIGAVEVVN RRLTGNNFHI YLKPDRLVDP        60
     EAFGVHGIAD EFLLDKPTFA DVADEFLDYI RGAELVIHNA SFDIGFMDYE FSKLNRDIPK       120
     TSSFCKVTDS LALARKMFPG KRNSLDALCS RYEIDNSKRT LHGALLDAQI LADVYLAMTG       180
     GQTSMTFAME GETQQQQGEE TIQRLVRQAR KLRVVFASDE EVAAHEARLD LVEKKGGSCL       240
     WRA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page