(data stored in ACNUC8465 zone)

EMBL: FN543502.ESPI

FN543502.ESPI        Location/Qualifiers
FT   CDS             complement(365395..366687)
FT                   /transl_table=11
FT                   /gene="espI"
FT                   /gene_synonym="nleA"
FT                   /locus_tag="ROD_03401"
FT                   /product="T3SS effector protein NleA/EspI"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87122"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ4"
FT                   /protein_id="CBG87122.1"
FT                   /translation="MNIQPNIHSGITTQNNQQHHHAEQVPVSSSIPRSDLPPNCEAGFV
FT                   VHIPEDIQQHVPECGETTALLSLIKDEGLLSGLDKYLAPHLEEGSLGKKALDTFGLFNV
FT                   TQMALEIPSSVPGISGKYGVQMNIVKPDIHPTTGNYFLQLFPLHDEIGFNFKDLPGPLK
FT                   NALTNSSISATASTVAPTPNDPMPWFGLTAQVVRNHGVELPIVKTENGWKLVGETPLTP
FT                   DGPKANYTEEWVIRPGEADFKYGTSPLQATLGLEFGAHFKWDLDNPNTKYAILTNAAAN
FT                   AIGAAGGFAVSKVPGIDPMLSPHVGAMLGQAAGHAVQCNTPGLKPDTILWWAGATFGAA
FT                   DLNKAEFDKVRFTDYPRIWFHAREGALFPNKQDIARVTGADIKAMEEGVPVGHQHPKPE
FT                   DVVIDIEGGNSPHHNPSNYVDTFEIIQETRV"
     MNIQPNIHSG ITTQNNQQHH HAEQVPVSSS IPRSDLPPNC EAGFVVHIPE DIQQHVPECG        60
     ETTALLSLIK DEGLLSGLDK YLAPHLEEGS LGKKALDTFG LFNVTQMALE IPSSVPGISG       120
     KYGVQMNIVK PDIHPTTGNY FLQLFPLHDE IGFNFKDLPG PLKNALTNSS ISATASTVAP       180
     TPNDPMPWFG LTAQVVRNHG VELPIVKTEN GWKLVGETPL TPDGPKANYT EEWVIRPGEA       240
     DFKYGTSPLQ ATLGLEFGAH FKWDLDNPNT KYAILTNAAA NAIGAAGGFA VSKVPGIDPM       300
     LSPHVGAMLG QAAGHAVQCN TPGLKPDTIL WWAGATFGAA DLNKAEFDKV RFTDYPRIWF       360
     HAREGALFPN KQDIARVTGA DIKAMEEGVP VGHQHPKPED VVIDIEGGNS PHHNPSNYVD       420
     TFEIIQETRV                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page